PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.1M393
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 421aa    MW: 46135.4 Da    PI: 8.1278
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.1M393genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.75.4e-28167220256
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                   r++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  Araip.1M393 167 SRVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGIDCLTRHNIASHLQKYRSH 220
                  69******************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.024163222IPR017930Myb domain
SuperFamilySSF466894.12E-18166223IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-26166223IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-26167220IPR006447Myb domain, plants
PfamPF002491.1E-7168218IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MLAVSPLRTN RDDEIQGQDL ETLSIIGEDD FAELSEGNLL ESINFDDLFA GISHADVLPD  60
LEMDPDIFAD FSLSGAHNSS SLVLNGCGKS ASSESGSSSR GEEIVSKRDG SVVVNPSPGN  120
KEGDNKGRKS SSSSSCQSKN PHQTKKKVKK VLSLSVYCRP ECEGTHSRVD WTPELHRRFV  180
QAVEQLGVDK AVPSRILEIM GIDCLTRHNI ASHLQKYRSH RKHILAREAE AASWSQRRQM  240
YGGGRGKREV SPWVAPTIGF PPTPITSMPP QFRPLHVWGH PTMHMWPPKP HQPPPPAPWP  300
SDPSYWHHPH HQRAHQKAVP PATPCFPQPL TTTRFGSPPT TTVAGIPPPQ RAIYKVDPGM  360
PKPLVDFHPS KESVDAAIGD VLSKPWLPLP LGLKAPAVEC VVGELQRQGI PKIPPSTPVL  420
N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-15168224763ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150402e-38AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016171232.10.0PREDICTED: transcription activator GLK1
SwissprotQ9SIV32e-88GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A0B2R2J41e-151A0A0B2R2J4_GLYSO; Transcription activator GLK1
TrEMBLI1LUI91e-151I1LUI9_SOYBN; Uncharacterized protein
STRINGGLYMA12G33430.11e-150(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.13e-65GBF's pro-rich region-interacting factor 1